PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT15779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NF-YA
Protein Properties Length: 261aa    MW: 28594.7 Da    PI: 9.982
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT15779genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.71.6e-32157213158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rkpylheSRh+hAl+R+Rg gGrF
   EMT15779 157 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRKPYLHESRHQHALKRARGAGGRF 213
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-35155216IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.934156216IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-26158213IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-23159181IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860161181IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-23190213IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MAAWGCKQQQ LNSKKSSKER KRLRRGCWVH LLERGCRREV ESGRRRQSNP GGSGGDGVFN  60
CDHRADEQQK QAAAQGNQEE APATSIGSQA MVATPSTDYV TPYGHQEACH AMGQIAYPTV  120
DPFYGSLYAA YGGQPMMHPP MVGMHAAAIP LPTDAIEEPV YVNAKQYNAI LRRRQSRAKA  180
ESERKLIKGR KPYLHESRHQ HALKRARGAG GRFLNAKSDD NEEHSDSSSK DKQNGVAPRS  240
SGQSSQSPKG ATSADKSANH E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-22156229174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0096240.0BT009624.1 Triticum aestivum clone wre1n.pk0143.h2:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237027.11e-114PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237028.11e-114PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_014758866.11e-114PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP14e-43NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLN1R0Y80.0N1R0Y8_AEGTA; Nuclear transcription factor Y subunit A-7
STRINGMLOC_52315.11e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65553853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-38nuclear factor Y, subunit A7